SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5n3wa2 (5n3w A:209-460)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2183652Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2183653Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2184575Family d.92.1.13: Zn aminopeptidase catalytic domain [64338] (5 protein domains)
    adopts thermolysin-like fold
  6. 2184591Protein Leukotriene A4 hydrolase catalytic domain [64339] (1 species)
  7. 2184592Species Human (Homo sapiens) [TaxId:9606] [64340] (50 PDB entries)
    Uniprot P09960
  8. 2289173Domain d5n3wa2: 5n3w A:209-460 [332474]
    Other proteins in same PDB: d5n3wa1, d5n3wa3
    automated match to d3u9wa2
    complexed with 8kw, act, imd, yb, zn

Details for d5n3wa2

PDB Entry: 5n3w (more details), 2.3 Å

PDB Description: crystal structure of lta4h bound to a selective inhibitor against ltb4 generation
PDB Compounds: (A:) Leukotriene A-4 hydrolase

SCOPe Domain Sequences for d5n3wa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n3wa2 d.92.1.13 (A:209-460) Leukotriene A4 hydrolase catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
lesrqigprtlvwsekeqveksayefsetesmlkiaedlggpyvwgqydllvlppsfpyg
gmenpcltfvtptllagdkslsnviaheishswtgnlvtnktwdhfwlneghtvylerhi
cgrlfgekfrhfnalggwgelqnsvktfgethpftklvvdltdidpdvayssvpyekgfa
llfyleqllggpeiflgflkayvekfsyksittddwkdflysyfkdkvdvlnqvdwnawl
yspglppikpny

SCOPe Domain Coordinates for d5n3wa2:

Click to download the PDB-style file with coordinates for d5n3wa2.
(The format of our PDB-style files is described here.)

Timeline for d5n3wa2:

  • d5n3wa2 appears in periodic updates to SCOPe 2.06 starting on 2017-03-30