Lineage for d5n3wa2 (5n3w A:209-460)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964698Family d.92.1.13: Zn aminopeptidase catalytic domain [64338] (5 proteins)
    adopts thermolysin-like fold
  6. 2964714Protein Leukotriene A4 hydrolase catalytic domain [64339] (1 species)
  7. 2964715Species Human (Homo sapiens) [TaxId:9606] [64340] (58 PDB entries)
    Uniprot P09960
  8. 2964770Domain d5n3wa2: 5n3w A:209-460 [332474]
    Other proteins in same PDB: d5n3wa1, d5n3wa3
    automated match to d3u9wa2
    complexed with 8kw, act, imd, yb, zn

Details for d5n3wa2

PDB Entry: 5n3w (more details), 2.3 Å

PDB Description: crystal structure of lta4h bound to a selective inhibitor against ltb4 generation
PDB Compounds: (A:) Leukotriene A-4 hydrolase

SCOPe Domain Sequences for d5n3wa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n3wa2 d.92.1.13 (A:209-460) Leukotriene A4 hydrolase catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
lesrqigprtlvwsekeqveksayefsetesmlkiaedlggpyvwgqydllvlppsfpyg
gmenpcltfvtptllagdkslsnviaheishswtgnlvtnktwdhfwlneghtvylerhi
cgrlfgekfrhfnalggwgelqnsvktfgethpftklvvdltdidpdvayssvpyekgfa
llfyleqllggpeiflgflkayvekfsyksittddwkdflysyfkdkvdvlnqvdwnawl
yspglppikpny

SCOPe Domain Coordinates for d5n3wa2:

Click to download the PDB-style file with coordinates for d5n3wa2.
(The format of our PDB-style files is described here.)

Timeline for d5n3wa2: