SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5n3wa1 (5n3w A:4-208)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2074640Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
    duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain
  4. 2074641Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) (S)
  5. 2074642Family b.98.1.1: Zn aminopeptidase N-terminal domain [63738] (4 protein domains)
  6. 2074658Protein Leukotriene A4 hydrolase N-terminal domain [63739] (1 species)
  7. 2074659Species Human (Homo sapiens) [TaxId:9606] [63740] (50 PDB entries)
    Uniprot P09960
  8. 2289172Domain d5n3wa1: 5n3w A:4-208 [332473]
    Other proteins in same PDB: d5n3wa2, d5n3wa3
    automated match to d3b7sa2
    complexed with 8kw, act, imd, yb, zn

Details for d5n3wa1

PDB Entry: 5n3w (more details), 2.3 Å

PDB Description: crystal structure of lta4h bound to a selective inhibitor against ltb4 generation
PDB Compounds: (A:) Leukotriene A-4 hydrolase

SCOPe Domain Sequences for d5n3wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n3wa1 b.98.1.1 (A:4-208) Leukotriene A4 hydrolase N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
vdtcslaspasvcrtkhlhlrcsvdftrrtltgtaaltvqsqednlrslvldtkdltiek
vvingqevkyalgerqsykgspmeislpialsknqeivieisfetspkssalqwltpeqt
sgkehpylfsqcqaihcrailpcqdtpsvkltytaevsvpkelvalmsairdgetpdped
psrkiykfiqkvpipcylialvvga

SCOPe Domain Coordinates for d5n3wa1:

Click to download the PDB-style file with coordinates for d5n3wa1.
(The format of our PDB-style files is described here.)

Timeline for d5n3wa1:

  • d5n3wa1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-30