Lineage for d5n3wa1 (5n3w A:4-208)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2074640Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
    duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain
  4. 2074641Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) (S)
  5. 2074642Family b.98.1.1: Zn aminopeptidase N-terminal domain [63738] (4 protein domains)
  6. 2074658Protein Leukotriene A4 hydrolase N-terminal domain [63739] (1 species)
  7. 2074659Species Human (Homo sapiens) [TaxId:9606] [63740] (56 PDB entries)
    Uniprot P09960
  8. 2289172Domain d5n3wa1: 5n3w A:4-208 [332473]
    Other proteins in same PDB: d5n3wa2, d5n3wa3
    automated match to d3b7sa2
    complexed with 8kw, act, imd, yb, zn

Details for d5n3wa1

PDB Entry: 5n3w (more details), 2.3 Å

PDB Description: crystal structure of lta4h bound to a selective inhibitor against ltb4 generation
PDB Compounds: (A:) Leukotriene A-4 hydrolase

SCOPe Domain Sequences for d5n3wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n3wa1 b.98.1.1 (A:4-208) Leukotriene A4 hydrolase N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
vdtcslaspasvcrtkhlhlrcsvdftrrtltgtaaltvqsqednlrslvldtkdltiek
vvingqevkyalgerqsykgspmeislpialsknqeivieisfetspkssalqwltpeqt
sgkehpylfsqcqaihcrailpcqdtpsvkltytaevsvpkelvalmsairdgetpdped
psrkiykfiqkvpipcylialvvga

SCOPe Domain Coordinates for d5n3wa1:

Click to download the PDB-style file with coordinates for d5n3wa1.
(The format of our PDB-style files is described here.)

Timeline for d5n3wa1:

  • d5n3wa1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-30