Lineage for d5isof2 (5iso F:183-325)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2167405Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 2167406Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 2167407Family d.37.1.1: CBS-domain pair [54632] (21 protein domains)
    Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain
  6. 2167408Protein 5'-AMP-activated protein kinase subunit gamma-1, AMPKg [160176] (1 species)
  7. 2167409Species Norway rat (Rattus norvegicus) [TaxId:10116] [160177] (10 PDB entries)
    Uniprot P80385 182-326! Uniprot P80385 23-181
  8. 2289171Domain d5isof2: 5iso F:183-325 [332472]
    automated match to d2v8qe1
    complexed with 992, amp, stu

Details for d5isof2

PDB Entry: 5iso (more details), 2.63 Å

PDB Description: structure of full length human ampk (non-phosphorylated at t-loop) in complex with a small molecule activator, a benzimidazole derivative (991)
PDB Compounds: (F:) 5'-amp-activated protein kinase subunit gamma-1

SCOPe Domain Sequences for d5isof2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5isof2 d.37.1.1 (F:183-325) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Norway rat (Rattus norvegicus) [TaxId: 10116]}
fpkpefmsksleelqigtyaniamvrtttpvyvalgifvqhrvsalpvvdekgrvvdiys
kfdvinlaaektynnldvsvtkalqhrshyfegvlkcylhetletiinrlveaevhrlvv
vdendvvkgivslsdilqalvlt

SCOPe Domain Coordinates for d5isof2:

Click to download the PDB-style file with coordinates for d5isof2.
(The format of our PDB-style files is described here.)

Timeline for d5isof2:

  • d5isof2 appears in periodic updates to SCOPe 2.06 starting on 2017-03-30

View in 3D
Domains from same chain:
(mouse over for more information)
d5isof1