SCOPe 2.06: Domain d5iwxe_: 5iwx E:

Lineage for d5iwxe_ (5iwx E:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.5: IpsF-like [69765] (2 families)
   forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.5.1: IpsF-like [69766] (3 proteins)
   automatically mapped to Pfam PF02542

6. Protein automated matches [190985] (5 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [332335] (2 PDB entries)

8. Domain d5iwxe_: 5iwx E: [332465]
   automated match to d1t0aa_
   complexed with mg

Details for d5iwxe_

PDB Entry: 5iwx, 1.99 Å

PDB Description: crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from bacillus subtitis

PDB Compounds: (E:) 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

SCOPe Domain Sequences for d5iwxe_:

Sequence, based on SEQRES records:

>d5iwxe_ d.79.5.1 (E:) automated matches {Bacillus subtilis [TaxId: 224308]}
mfrigqgfdvhqlvegrpliiggieipyekgllghsdadvllhtvadaclgavgegdigk
hfpdtdpefkdadsfkllqhvwgivkqkgyvlgnidctiiaqkpkmlpyiedmrkriaeg
leadvsqvnvkattteklgftgraegiaaqatvliqkg

Sequence, based on observed residues (ATOM records):

>d5iwxe_ d.79.5.1 (E:) automated matches {Bacillus subtilis [TaxId: 224308]}
mfrigqgfdvhqlvegrpliiggieipyekgllghsdadvllhtvadaclgavgegdigk
hfpdsfkllqhvwgivkqkgyvlgnidctiiaqkpkmlpyiedmrkriaegleadvsqvn
vkattteklgftgraegiaaqatvliqkg

Timeline for d5iwxe_:

• d5iwxe_ is new in SCOPe 2.06-stable
  
• d5iwxe_ appears in SCOPe 2.07
  
• d5iwxe_ appears in the current release, SCOPe 2.08