Lineage for d5iw1b1 (5iw1 B:3-111)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. Protein automated matches [190740] (30 species)
    not a true protein
  7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. Domain d5iw1b1: 5iw1 B:3-111 [332463]
    Other proteins in same PDB: d5iw1c1
    automated match to d3mffb1

Details for d5iw1b1

PDB Entry: 5iw1 (more details), 3 Å

PDB Description: crystal structure of b4.2.3 t-cell receptor
PDB Compounds: (B:) T-cell receptor beta chain

SCOPe Domain Sequences for d5iw1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iw1b1 b.1.1.0 (B:3-111) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vtqmprylikrmgenvllecgqdmshetmywyrqdpglglqliyisydvdsnsegdipkg
yrvsrkkrehfslildsaktnqtsvyfcasslghtevffgkgtrltvve

SCOPe Domain Coordinates for d5iw1b1 are not available.

Timeline for d5iw1b1:

Domains from same chain:
(mouse over for more information)
d5iw1b2
Domains from other chains:
(mouse over for more information)
d5iw1a1, d5iw1a2, d5iw1c1, d5iw1c2, d5iw1d1, d5iw1d2, d5iw1e1, d5iw1e2, d5iw1f1, d5iw1f2