Lineage for d5iw1e2 (5iw1 E:117-191)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2357727Species Mouse (Mus musculus) [TaxId:10090] [188198] (590 PDB entries)
  8. 2358667Domain d5iw1e2: 5iw1 E:117-191 [332458]
    Other proteins in same PDB: d5iw1c1
    automated match to d1tcra2

Details for d5iw1e2

PDB Entry: 5iw1 (more details), 3 Å

PDB Description: crystal structure of b4.2.3 t-cell receptor
PDB Compounds: (E:) T-cell receptor alpha chain

SCOPe Domain Sequences for d5iw1e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iw1e2 b.1.1.0 (E:117-191) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpepavyqlkdprsqdstlclftdfdsqinvpktmesgtfitdkcvldmkamdsksng
aiawsnqtsftcqdi

SCOPe Domain Coordinates for d5iw1e2:

Click to download the PDB-style file with coordinates for d5iw1e2.
(The format of our PDB-style files is described here.)

Timeline for d5iw1e2: