![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (17 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries) |
![]() | Domain d5iw3a1: 5iw3 A:259-362 [332453] Other proteins in same PDB: d5iw3a2 automated match to d1iisb3 complexed with act, bma, gal, man, nag, so4 |
PDB Entry: 5iw3 (more details), 2.05 Å
SCOPe Domain Sequences for d5iw3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5iw3a1 b.1.1.2 (A:259-362) automated matches {Human (Homo sapiens) [TaxId: 9606]} ggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiska
Timeline for d5iw3a1: