SCOPe 2.06: Domain d5iw3a1: 5iw3 A:259-362

Lineage for d5iw3a1 (5iw3 A:259-362)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)

8. Domain d5iw3a1: 5iw3 A:259-362 [332453]
   Other proteins in same PDB: d5iw3a2
   automated match to d1iisb3
   complexed with act, bma, gal, man, nag, so4

Details for d5iw3a1

PDB Entry: 5iw3, 2.05 Å

PDB Description: anti-cd20 monoclonal antibody fc fragment

PDB Compounds: (A:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d5iw3a1:

Sequence; same for both SEQRES and ATOM records:

>d5iw3a1 b.1.1.2 (A:259-362) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq
ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiska

Timeline for d5iw3a1:

• d5iw3a1 is new in SCOPe 2.06-stable
  
• d5iw3a1 appears in SCOPe 2.07
  
• d5iw3a1 appears in the current release, SCOPe 2.08