Lineage for d5iw3a1 (5iw3 A:259-362)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024392Protein automated matches [190374] (14 species)
    not a true protein
  7. 2024406Species Human (Homo sapiens) [TaxId:9606] [187221] (683 PDB entries)
  8. 2289152Domain d5iw3a1: 5iw3 A:259-362 [332453]
    Other proteins in same PDB: d5iw3a2
    automated match to d1iisb3
    complexed with act, bma, gal, man, nag, so4

Details for d5iw3a1

PDB Entry: 5iw3 (more details), 2.05 Å

PDB Description: anti-cd20 monoclonal antibody fc fragment
PDB Compounds: (A:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d5iw3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iw3a1 b.1.1.2 (A:259-362) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq
ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiska

SCOPe Domain Coordinates for d5iw3a1:

Click to download the PDB-style file with coordinates for d5iw3a1.
(The format of our PDB-style files is described here.)

Timeline for d5iw3a1:

  • d5iw3a1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-30

View in 3D
Domains from same chain:
(mouse over for more information)
d5iw3a2