SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5iw3a1 (5iw3 A:259-362)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024392Protein automated matches [190374] (13 species)
    not a true protein
  7. 2024406Species Human (Homo sapiens) [TaxId:9606] [187221] (610 PDB entries)
  8. 2289152Domain d5iw3a1: 5iw3 A:259-362 [332453]
    Other proteins in same PDB: d5iw3a2
    automated match to d1iisb3
    complexed with act, bma, gal, man, nag, so4

Details for d5iw3a1

PDB Entry: 5iw3 (more details), 2.05 Å

PDB Description: anti-cd20 monoclonal antibody fc fragment
PDB Compounds: (A:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d5iw3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iw3a1 b.1.1.2 (A:259-362) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq
ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiska

SCOPe Domain Coordinates for d5iw3a1:

Click to download the PDB-style file with coordinates for d5iw3a1.
(The format of our PDB-style files is described here.)

Timeline for d5iw3a1:

  • d5iw3a1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-30

View in 3D
Domains from same chain:
(mouse over for more information)
d5iw3a2