Lineage for d5jnsa_ (5jns A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116033Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 2116034Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families) (S)
    share the common active site structure with the family II
  5. 2116035Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (3 protein domains)
    automatically mapped to Pfam PF01451
  6. 2116059Protein Tyrosine phosphatase [52790] (5 species)
  7. 2116076Species Human (Homo sapiens) [TaxId:9606] [52792] (10 PDB entries)
  8. 2289151Domain d5jnsa_: 5jns A: [332452]
    automated match to d5pnta_
    complexed with dms, po4

Details for d5jnsa_

PDB Entry: 5jns (more details), 1.8 Å

PDB Description: crystal structure of human low molecular weight protein tyrosine phosphatase (lmptp) type a complexed with phosphate
PDB Compounds: (A:) Low molecular weight phosphotyrosine protein phosphatase

SCOPe Domain Sequences for d5jnsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jnsa_ c.44.1.1 (A:) Tyrosine phosphatase {Human (Homo sapiens) [TaxId: 9606]}
tksvlfvclgnicrspiaeavfrklvtdqnisenwrvdsaatsgyeignppdyrgqscmk
rhgipmshvarqitkedfatfdyilcmdesnlrdlnrksnqvktckakiellgsydpqkq
liiedpyygndsdfetvyqqcvrccrafleka

SCOPe Domain Coordinates for d5jnsa_:

Click to download the PDB-style file with coordinates for d5jnsa_.
(The format of our PDB-style files is described here.)

Timeline for d5jnsa_:

  • d5jnsa_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-30