Lineage for d5jwob_ (5jwo B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2133714Family c.47.1.15: KaiB-like [102449] (3 proteins)
    Pfam PF07689; contains members with alternative folds
  6. 2133728Protein automated matches [190797] (3 species)
    not a true protein
  7. 2133741Species Thermosynechococcus elongatus [TaxId:197221] [188059] (5 PDB entries)
  8. 2133742Domain d5jwob_: 5jwo B: [332449]
    automated match to d2qkeb_
    complexed with adp

Details for d5jwob_

PDB Entry: 5jwo (more details), 1.8 Å

PDB Description: crystal structure of foldswitch-stabilized kaib in complex with the n- terminal ci domain of kaic from thermosynechococcus elongatus
PDB Compounds: (B:) Circadian clock protein kaiB

SCOPe Domain Sequences for d5jwob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jwob_ c.47.1.15 (B:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
tavlklyvagntpnsvralktlnnilekefkgvyalkvidvlknpqlaeedkilatptla
kvlpppvrriigdlsnrekvlialrlla

SCOPe Domain Coordinates for d5jwob_:

Click to download the PDB-style file with coordinates for d5jwob_.
(The format of our PDB-style files is described here.)

Timeline for d5jwob_: