SCOPe 2.06: Domain d2nc9a_: 2nc9 A:

Lineage for d2nc9a_ (2nc9 A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (9 families)

5. Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (20 proteins)
   this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain

6. Protein Hop [48456] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48457] (4 PDB entries)

8. Domain d2nc9a_: 2nc9 A: [332442]
   automated match to d1elra_

Details for d2nc9a_

PDB Entry: 2nc9

PDB Description: apo solution structure of hop tpr2a

PDB Compounds: (A:) Stress-induced-phosphoprotein 1

SCOPe Domain Sequences for d2nc9a_:

Sequence; same for both SEQRES and ATOM records:

>d2nc9a_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]}
enkkqalkekelgndaykkkdfdtalkhydkakeldptnmtyitnqaavyfekgdynkcr
elcekaievgrenredyrqiakayarignsyfkeekykdaihfynkslaehrtpdvlkkc
qqaekilkeqe

Timeline for d2nc9a_:

• d2nc9a_ is new in SCOPe 2.06-stable
  
• d2nc9a_ appears in SCOPe 2.07
  
• d2nc9a_ appears in the current release, SCOPe 2.08