SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2nc9a_ (2nc9 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007336Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 2007337Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (20 protein domains)
  6. 2007359Protein Hop [48456] (1 species)
  7. 2007360Species Human (Homo sapiens) [TaxId:9606] [48457] (4 PDB entries)
  8. 2289141Domain d2nc9a_: 2nc9 A: [332442]
    automated match to d1elra_

Details for d2nc9a_

PDB Entry: 2nc9 (more details)

PDB Description: apo solution structure of hop tpr2a
PDB Compounds: (A:) Stress-induced-phosphoprotein 1

SCOPe Domain Sequences for d2nc9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nc9a_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]}
enkkqalkekelgndaykkkdfdtalkhydkakeldptnmtyitnqaavyfekgdynkcr
elcekaievgrenredyrqiakayarignsyfkeekykdaihfynkslaehrtpdvlkkc
qqaekilkeqe

SCOPe Domain Coordinates for d2nc9a_:

Click to download the PDB-style file with coordinates for d2nc9a_.
(The format of our PDB-style files is described here.)

Timeline for d2nc9a_:

  • d2nc9a_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-30