Lineage for d5jnva_ (5jnv A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116033Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 2116034Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families) (S)
    share the common active site structure with the family II
  5. 2116035Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (3 protein domains)
    automatically mapped to Pfam PF01451
  6. 2116059Protein Tyrosine phosphatase [52790] (5 species)
  7. 2116067Species Cow (Bos taurus) [TaxId:9913] [52791] (9 PDB entries)
  8. 2289134Domain d5jnva_: 5jnv A: [332435]
    automated match to d1dg9a_
    complexed with dms, epe; mutant

Details for d5jnva_

PDB Entry: 5jnv (more details), 1.6 Å

PDB Description: crystal structure of bovine low molecular weight protein tyrosine phosphatase (lmptp) mutant (w49y n50e) complexed with hepes
PDB Compounds: (A:) Low molecular weight phosphotyrosine protein phosphatase

SCOPe Domain Sequences for d5jnva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jnva_ c.44.1.1 (A:) Tyrosine phosphatase {Cow (Bos taurus) [TaxId: 9913]}
vtksvlfvclgnicrspiaeavfrklvtdqnisdnwvidsgavsdyevgrspdpravscl
rnhgintahkarqvtkedfvtfdyilcmdesnlrdlnrksnqvkncrakiellgsydpqk
qliiedpyygndadfetvyqqcvrccraflekvr

SCOPe Domain Coordinates for d5jnva_:

Click to download the PDB-style file with coordinates for d5jnva_.
(The format of our PDB-style files is described here.)

Timeline for d5jnva_:

  • d5jnva_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-30