Lineage for d5k39a1 (5k39 A:4-163)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2033752Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2033774Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) (S)
  5. 2033894Family b.2.2.0: automated matches [191610] (1 protein)
    not a true family
  6. 2033895Protein automated matches [191113] (9 species)
    not a true protein
  7. 2289128Species Ruminiclostridium thermocellum [TaxId:1249482] [332429] (1 PDB entry)
  8. 2289129Domain d5k39a1: 5k39 A:4-163 [332430]
    Other proteins in same PDB: d5k39a2, d5k39a3, d5k39b1, d5k39b2
    automated match to d4fl4b_
    complexed with ca

Details for d5k39a1

PDB Entry: 5k39 (more details), 1.98 Å

PDB Description: the type ii cohesin dockerin complex from clostridium thermocellum
PDB Compounds: (A:) Cellulosome anchoring protein cohesin region

SCOPe Domain Sequences for d5k39a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k39a1 b.2.2.0 (A:4-163) automated matches {Ruminiclostridium thermocellum [TaxId: 1249482]}
ahialeldktkvkvgdvivatvkaknmtsmagiqvnikydpevlqaidpatgkpftketl
lvdpellsnreynplltavndinsgiinyascyvywdsyresgvsestgiigkvgfkvlk
aanttvkleetrftpnsidgtlvidwygqqivgykviqpd

SCOPe Domain Coordinates for d5k39a1:

Click to download the PDB-style file with coordinates for d5k39a1.
(The format of our PDB-style files is described here.)

Timeline for d5k39a1:

  • d5k39a1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-30