SCOPe 2.06: Domain d5jyta1: 5jyt A:1-99

Lineage for d5jyta1 (5jyt A:1-99)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.15: KaiB-like [102449] (3 proteins)
   Pfam PF07689; contains members with alternative folds

6. Protein automated matches [190797] (3 species)
   not a true protein

7. Species Thermosynechococcus elongatus [TaxId:197221] [188059] (5 PDB entries)

8. Domain d5jyta1: 5jyt A:1-99 [332427]
   Other proteins in same PDB: d5jyta2
   automated match to d2qkeb_

Details for d5jyta1

PDB Entry: 5jyt

PDB Description: nmr structure of foldswitch-stablized kaib from thermosynechococcus elongatus

PDB Compounds: (A:) Circadian clock protein kaiB

SCOPe Domain Sequences for d5jyta1:

Sequence; same for both SEQRES and ATOM records:

>d5jyta1 c.47.1.15 (A:1-99) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
maplrktavlklyvagntpnsvralktlanilekefkgvyalkvidvlknpqlaeedkil
atptlakvlpppvrriigdlsnrekvlialrllaeeigd

Timeline for d5jyta1:

• d5jyta1 is new in SCOPe 2.06-stable
  
• d5jyta1 appears in SCOPe 2.07
  
• d5jyta1 appears in the current release, SCOPe 2.08