Lineage for d5jyta1 (5jyt A:1-99)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116932Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2116933Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2118848Family c.47.1.15: KaiB-like [102449] (3 protein domains)
    Pfam PF07689; contains members with alternative folds
  6. 2118862Protein automated matches [190797] (3 species)
    not a true protein
  7. 2118875Species Thermosynechococcus elongatus [TaxId:197221] [188059] (5 PDB entries)
  8. 2289126Domain d5jyta1: 5jyt A:1-99 [332427]
    Other proteins in same PDB: d5jyta2
    automated match to d2qkeb_

Details for d5jyta1

PDB Entry: 5jyt (more details)

PDB Description: nmr structure of foldswitch-stablized kaib from thermosynechococcus elongatus
PDB Compounds: (A:) Circadian clock protein kaiB

SCOPe Domain Sequences for d5jyta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jyta1 c.47.1.15 (A:1-99) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
maplrktavlklyvagntpnsvralktlanilekefkgvyalkvidvlknpqlaeedkil
atptlakvlpppvrriigdlsnrekvlialrllaeeigd

SCOPe Domain Coordinates for d5jyta1:

Click to download the PDB-style file with coordinates for d5jyta1.
(The format of our PDB-style files is described here.)

Timeline for d5jyta1:

  • d5jyta1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-30

View in 3D
Domains from same chain:
(mouse over for more information)
d5jyta2