SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jyta1 (5jyt A:1-99)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116932Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2116933Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2118848Family c.47.1.15: KaiB-like [102449] (3 protein domains)
    Pfam PF07689; contains members with alternative folds
  6. 2118862Protein automated matches [190797] (3 species)
    not a true protein
  7. 2118875Species Thermosynechococcus elongatus [TaxId:197221] [188059] (5 PDB entries)
  8. 2289126Domain d5jyta1: 5jyt A:1-99 [332427]
    Other proteins in same PDB: d5jyta2
    automated match to d2qkeb_

Details for d5jyta1

PDB Entry: 5jyt (more details)

PDB Description: nmr structure of foldswitch-stablized kaib from thermosynechococcus elongatus
PDB Compounds: (A:) Circadian clock protein kaiB

SCOPe Domain Sequences for d5jyta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jyta1 c.47.1.15 (A:1-99) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
maplrktavlklyvagntpnsvralktlanilekefkgvyalkvidvlknpqlaeedkil
atptlakvlpppvrriigdlsnrekvlialrllaeeigd

SCOPe Domain Coordinates for d5jyta1:

Click to download the PDB-style file with coordinates for d5jyta1.
(The format of our PDB-style files is described here.)

Timeline for d5jyta1:

  • d5jyta1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-30

View in 3D
Domains from same chain:
(mouse over for more information)
d5jyta2