Lineage for d5kwjb_ (5kwj B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2900132Family c.69.1.3: Mycobacterial antigens [53491] (5 proteins)
    automatically mapped to Pfam PF00756
  6. 2900153Protein automated matches [227016] (2 species)
    not a true protein
  7. 2900154Species Mycobacterium tuberculosis [TaxId:1773] [225761] (6 PDB entries)
  8. 2900160Domain d5kwjb_: 5kwj B: [332419]
    automated match to d1sfra_
    complexed with 6y3

Details for d5kwjb_

PDB Entry: 5kwj (more details), 2.01 Å

PDB Description: m.tb ag85c modified at c209 by amino-ebselen
PDB Compounds: (B:) Diacylglycerol acyltransferase/mycolyltransferase Ag85C

SCOPe Domain Sequences for d5kwjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kwjb_ c.69.1.3 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mfsrpglpveylqvpsasmgrdikvqfqgggphavylldglraqddyngwdintpafeey
yqsglsvimpvggqssfytdwyqpsqsngqnytykwetfltrempawlqankgvsptgna
avglsmsggsalilaayypqqfpyaaslsgflnpsegwwptliglamndsggynansmwg
pssdpawkrndpmvqiprlvanntriwvycgngtpsdlggdnipakflegltlrtnqtfr
dtyaadggrngvfnfppngthswpywneqlvamkadiqhvlng

SCOPe Domain Coordinates for d5kwjb_:

Click to download the PDB-style file with coordinates for d5kwjb_.
(The format of our PDB-style files is described here.)

Timeline for d5kwjb_: