SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ipaa2 (5ipa A:95-214)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008141Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2008142Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2008143Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 protein domains)
  6. 2008150Protein Ethr repressor [109978] (2 species)
  7. 2289040Species Mycobacterium tuberculosis [TaxId:419947] [332341] (4 PDB entries)
  8. 2289103Domain d5ipaa2: 5ipa A:95-214 [332404]
    Other proteins in same PDB: d5ipaa1
    automated match to d1t56a2
    complexed with 6c8

Details for d5ipaa2

PDB Entry: 5ipa (more details), 1.78 Å

PDB Description: structure of transcriptional regulatory repressor protein - ethr from mycobacterium tuberculosis in complex with (e)-3-(furan-3-yl)-1- (pyrrolidin-1-yl)prop-2-en-1-one at 1.78a resolution
PDB Compounds: (A:) TetR-family transcriptional regulatory repressor protein

SCOPe Domain Sequences for d5ipaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ipaa2 a.121.1.1 (A:95-214) Ethr repressor {Mycobacterium tuberculosis [TaxId: 419947]}
adtdrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavid
aerdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge

SCOPe Domain Coordinates for d5ipaa2:

Click to download the PDB-style file with coordinates for d5ipaa2.
(The format of our PDB-style files is described here.)

Timeline for d5ipaa2:

  • d5ipaa2 appears in periodic updates to SCOPe 2.06 starting on 2017-03-30

View in 3D
Domains from same chain:
(mouse over for more information)
d5ipaa1