SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5j3la1 (5j3l A:22-94)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1981148Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1981577Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 protein domains)
  6. 1981584Protein Ethr repressor [109651] (2 species)
  7. 1981585Species Mycobacterium tuberculosis [TaxId:1773] [109652] (16 PDB entries)
    Uniprot P96222 22-215
  8. 2289094Domain d5j3la1: 5j3l A:22-94 [332395]
    Other proteins in same PDB: d5j3la2
    automated match to d1t56a1
    complexed with 6fr

Details for d5j3la1

PDB Entry: 5j3l (more details), 1.66 Å

PDB Description: structure of transcriptional regulatory repressor protein - ethr from mycobacterium tuberculosis in complex with 1-((2-cyclopentylethyl) sulfonyl)pyrrolidine at 1.66a resolution
PDB Compounds: (A:) HTH-type transcriptional regulator EthR

SCOPe Domain Sequences for d5j3la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j3la1 a.4.1.9 (A:22-94) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
gddrelailataenlledrpladisvddlakgagisrptfyfyfpskeavlltlldrvvn
qadmalqtlaenp

SCOPe Domain Coordinates for d5j3la1:

Click to download the PDB-style file with coordinates for d5j3la1.
(The format of our PDB-style files is described here.)

Timeline for d5j3la1:

  • d5j3la1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-30

View in 3D
Domains from same chain:
(mouse over for more information)
d5j3la2