SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5k4hd_ (5k4h D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142620Fold c.88: Glutaminase/Asparaginase [53773] (1 superfamily)
    consists of two non-similar alpha/beta domains, 3 layers (a/b/a) each
    Domain 1 has mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest; left-handed crossover connection between strands 4 and 5
    Domain 2 has parallel beta-sheet of 4 strands, order 1234
  4. 2142621Superfamily c.88.1: Glutaminase/Asparaginase [53774] (2 families) (S)
  5. 2142622Family c.88.1.1: Glutaminase/Asparaginase [53775] (4 protein domains)
    automatically mapped to Pfam PF00710
  6. 2142623Protein Asparaginase type II [53776] (5 species)
  7. 2289052Species Wolinella succinogenes [TaxId:273121] [332353] (4 PDB entries)
  8. 2289091Domain d5k4hd_: 5k4h D: [332392]
    automated match to d1wsaa_
    complexed with glu

Details for d5k4hd_

PDB Entry: 5k4h (more details), 2 Å

PDB Description: wolinella succinogenes l-asparaginase s121 + l-glutamic acid
PDB Compounds: (D:) L-asparaginase

SCOPe Domain Sequences for d5k4hd_:

Sequence, based on SEQRES records: (download)

>d5k4hd_ c.88.1.1 (D:) Asparaginase type II {Wolinella succinogenes [TaxId: 273121]}
kpqvtilatggtiagsgessvkssysagavtvdkllaavpaindlatikgeqissigsqe
mtgkvwlklakrvnellaqketeaviithgtdtmeetafflnltvksqkpvvlvgamrsg
ssmsadgpmnlynavnvainkastnkgvvivmndeihaareatklnttavnafaspntgk
igtvyygkveyftqsvrphtlasefdiskieelprvdilyahpddtdvlvnaalqagakg
iihagmgngnpfpltqnalekaaksgvvvarssrvgsgsttqeaevddkklgfvatesln
pqkarvllmlaltktsdreaiqkifsty

Sequence, based on observed residues (ATOM records): (download)

>d5k4hd_ c.88.1.1 (D:) Asparaginase type II {Wolinella succinogenes [TaxId: 273121]}
kpqvtilatggtiagssagavtvdkllaavpaindlatikgeqissigsqemtgkvwlkl
akrvnellaqketeaviithgtdtmeetafflnltvksqkpvvlvgamrsgssmsadgpm
nlynavnvainkastnkgvvivmndeihaareatklnttavnafaspntgkigtvyygkv
eyftqsvrphtlasefdiskieelprvdilyahpddtdvlvnaalqagakgiihagmgng
npfpltqnalekaaksgvvvarssrvgsgsttqeaevddkklgfvateslnpqkarvllm
laltktsdreaiqkifsty

SCOPe Domain Coordinates for d5k4hd_:

Click to download the PDB-style file with coordinates for d5k4hd_.
(The format of our PDB-style files is described here.)

Timeline for d5k4hd_:

  • d5k4hd_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-30