SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5iwea2 (5iwe A:129-278)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2164557Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 2164558Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 2164608Family d.21.1.2: PhzC/PhzF-like [89863] (4 protein domains)
    Pfam PF02567
  6. 2164637Protein Phenazine biosynthesis protein PhzF [117861] (1 species)
  7. 2164638Species Pseudomonas fluorescens [TaxId:294] [117862] (7 PDB entries)
    Uniprot Q51792
  8. 2289084Domain d5iwea2: 5iwe A:129-278 [332385]
    Other proteins in same PDB: d5iwea3
    automated match to d1xuba2
    complexed with edo, gol, peg, w81; mutant

Details for d5iwea2

PDB Entry: 5iwe (more details), 1.71 Å

PDB Description: e45q mutant of phenazine biosynthesis protein phzf in complex with (5r,6r)-6-azaniumyl-5-ethoxycyclohexa-1,3-diene-1-carboxylate
PDB Compounds: (A:) Trans-2,3-dihydro-3-hydroxyanthranilate isomerase

SCOPe Domain Sequences for d5iwea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iwea2 d.21.1.2 (A:129-278) Phenazine biosynthesis protein PhzF {Pseudomonas fluorescens [TaxId: 294]}
rdaellkalgisdstfpieiyhngprhvfvglpsidalsalhpdhralsnfhdmaincfa
gagrrwrsrmfspaygvvedaatgsaagplaihlarhgqiefgqpveilqgveigrpslm
fakaegraeqltrvevsgngvtfgrgtivl

SCOPe Domain Coordinates for d5iwea2:

Click to download the PDB-style file with coordinates for d5iwea2.
(The format of our PDB-style files is described here.)

Timeline for d5iwea2:

  • d5iwea2 appears in periodic updates to SCOPe 2.06 starting on 2017-03-30