SCOPe 2.06: Domain d5iwea1: 5iwe A:1-128

Lineage for d5iwea1 (5iwe A:1-128)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
   mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix

4. Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families)
   duplication: consists of two similar domain swapped with C-terminal strands

5. Family d.21.1.2: PhzC/PhzF-like [89863] (4 proteins)
   Pfam PF02567

6. Protein Phenazine biosynthesis protein PhzF [117861] (1 species)

7. Species Pseudomonas fluorescens [TaxId:294] [117862] (7 PDB entries)
   Uniprot Q51792

8. Domain d5iwea1: 5iwe A:1-128 [332384]
   Other proteins in same PDB: d5iwea3
   automated match to d1u1wa1
   complexed with edo, gol, peg, w81; mutant

Details for d5iwea1

PDB Entry: 5iwe, 1.71 Å

PDB Description: e45q mutant of phenazine biosynthesis protein phzf in complex with (5r,6r)-6-azaniumyl-5-ethoxycyclohexa-1,3-diene-1-carboxylate

PDB Compounds: (A:) Trans-2,3-dihydro-3-hydroxyanthranilate isomerase

SCOPe Domain Sequences for d5iwea1:

Sequence; same for both SEQRES and ATOM records:

>d5iwea1 d.21.1.2 (A:1-128) Phenazine biosynthesis protein PhzF {Pseudomonas fluorescens [TaxId: 294]}
mhnyviidafasvplegnpvavffdaddlppaqmqriaremnlsqstfvlkprnggdali
riftpvnelpfaghpllgtaialgahtdnhrlyletqmgtiafelerqngsviaasmdqp
iptwtalg

Timeline for d5iwea1:

• d5iwea1 is new in SCOPe 2.06-stable
  
• d5iwea1 appears in SCOPe 2.07
  
• d5iwea1 appears in the current release, SCOPe 2.08