SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ioza2 (5ioz A:95-214)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008141Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2008142Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2008143Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 protein domains)
  6. 2008150Protein Ethr repressor [109978] (2 species)
  7. 2289040Species Mycobacterium tuberculosis [TaxId:419947] [332341] (4 PDB entries)
  8. 2289082Domain d5ioza2: 5ioz A:95-214 [332383]
    Other proteins in same PDB: d5ioza1
    automated match to d1t56a2
    complexed with 6c4

Details for d5ioza2

PDB Entry: 5ioz (more details), 2.02 Å

PDB Description: structure of transcriptional regulatory repressor protein - ethr from mycobacterium tuberculosis in complex with n-(cyclopentylmethyl) cyclopentanecarboxamide at 2.02a resolution
PDB Compounds: (A:) TetR-family transcriptional regulatory repressor protein

SCOPe Domain Sequences for d5ioza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ioza2 a.121.1.1 (A:95-214) Ethr repressor {Mycobacterium tuberculosis [TaxId: 419947]}
adtdrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavid
aerdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge

SCOPe Domain Coordinates for d5ioza2:

Click to download the PDB-style file with coordinates for d5ioza2.
(The format of our PDB-style files is described here.)

Timeline for d5ioza2:

  • d5ioza2 appears in periodic updates to SCOPe 2.06 starting on 2017-03-30

View in 3D
Domains from same chain:
(mouse over for more information)
d5ioza1