SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5in2a_ (5in2 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2031006Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2031581Family b.1.8.0: automated matches [191527] (1 protein)
    not a true family
  6. 2031582Protein automated matches [190890] (7 species)
    not a true protein
  7. 2289079Species Onchocerca volvulus [TaxId:6282] [332380] (1 PDB entry)
  8. 2289080Domain d5in2a_: 5in2 A: [332381]
    automated match to d3km1a_
    complexed with azi, cl, cu, gol, pge, so4, zn

Details for d5in2a_

PDB Entry: 5in2 (more details), 1.55 Å

PDB Description: crystal structure of extra cellular cu/zn superoxide dismutase from onchocerca volvulus at 1.5 angstrom; insight into novel binding site and new inhibitors
PDB Compounds: (A:) Extracellular superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d5in2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5in2a_ b.1.8.0 (A:) automated matches {Onchocerca volvulus [TaxId: 6282]}
arravavlrgdagvsgiiyfqqgsggsittisgsvsgltpglhgfhvhqygdqtngctsa
gdhynpfgkthggpndrikhigdlgnivagangvaevyinsydiklrgplsvighslvvh
antddlgqgtgnmreeslktgnagsrlacgvigiaa

SCOPe Domain Coordinates for d5in2a_:

Click to download the PDB-style file with coordinates for d5in2a_.
(The format of our PDB-style files is described here.)

Timeline for d5in2a_:

  • d5in2a_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-30