Lineage for d5k39b1 (5k39 B:7-102)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2034780Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2034930Superfamily b.3.2: Carboxypeptidase regulatory domain-like [49464] (3 families) (S)
  5. 2034943Family b.3.2.0: automated matches [275446] (1 protein)
    not a true family
  6. 2034944Protein automated matches [275447] (3 species)
    not a true protein
  7. 2289075Species Clostridium thermocellum [TaxId:1249482] [332376] (1 PDB entry)
  8. 2289076Domain d5k39b1: 5k39 B:7-102 [332377]
    Other proteins in same PDB: d5k39a1, d5k39a2, d5k39a3, d5k39b2
    automated match to d4u3sb1
    complexed with ca

Details for d5k39b1

PDB Entry: 5k39 (more details), 1.98 Å

PDB Description: the type ii cohesin dockerin complex from clostridium thermocellum
PDB Compounds: (B:) Dockerin module from a protein of unknown function

SCOPe Domain Sequences for d5k39b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k39b1 b.3.2.0 (B:7-102) automated matches {Clostridium thermocellum [TaxId: 1249482]}
dkttvsgyisvdfdyppeseskiksgfnvkvagtelstktdekgyfeisgipgdmreftl
eiskrnylkrnvtvngtgklvvstednplilwagdv

SCOPe Domain Coordinates for d5k39b1:

Click to download the PDB-style file with coordinates for d5k39b1.
(The format of our PDB-style files is described here.)

Timeline for d5k39b1:

  • d5k39b1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-30