SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5k39b1 (5k39 B:7-102)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2034780Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2034930Superfamily b.3.2: Carboxypeptidase regulatory domain-like [49464] (3 families) (S)
  5. 2034943Family b.3.2.0: automated matches [275446] (1 protein)
    not a true family
  6. 2034944Protein automated matches [275447] (2 species)
    not a true protein
  7. 2289075Species Clostridium thermocellum [TaxId:1249482] [332376] (1 PDB entry)
  8. 2289076Domain d5k39b1: 5k39 B:7-102 [332377]
    Other proteins in same PDB: d5k39a1, d5k39a2, d5k39a3, d5k39b2
    automated match to d4u3sb1
    complexed with ca

Details for d5k39b1

PDB Entry: 5k39 (more details), 1.98 Å

PDB Description: the type ii cohesin dockerin complex from clostridium thermocellum
PDB Compounds: (B:) Dockerin module from a protein of unknown function

SCOPe Domain Sequences for d5k39b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k39b1 b.3.2.0 (B:7-102) automated matches {Clostridium thermocellum [TaxId: 1249482]}
dkttvsgyisvdfdyppeseskiksgfnvkvagtelstktdekgyfeisgipgdmreftl
eiskrnylkrnvtvngtgklvvstednplilwagdv

SCOPe Domain Coordinates for d5k39b1:

Click to download the PDB-style file with coordinates for d5k39b1.
(The format of our PDB-style files is described here.)

Timeline for d5k39b1:

  • d5k39b1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-30