SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ivub_ (5ivu B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2188399Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2188400Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2188605Family d.109.1.0: automated matches [191561] (1 protein)
    not a true family
  6. 2188606Protein automated matches [190971] (12 species)
    not a true protein
  7. 2289071Species Streptomyces griseoflavus [TaxId:35619] [332372] (1 PDB entry)
  8. 2289072Domain d5ivub_: 5ivu B: [332373]
    automated match to d1tvja_

Details for d5ivub_

PDB Entry: 5ivu (more details), 2.42 Å

PDB Description: crystal structure of streptomyces griseoflavus cofilin
PDB Compounds: (B:) cofilin

SCOPe Domain Sequences for d5ivub_:

Sequence, based on SEQRES records: (download)

>d5ivub_ d.109.1.0 (B:) automated matches {Streptomyces griseoflavus [TaxId: 35619]}
gvtlndacvetyqqlklgkklkyiifhlnkenteiavekssdsvdydnfladlpedecrw
avydleyekeegagkrnkltfvswapdsakmkqkmayasskdilrraltgiaveiqgtdf
sevahenvldkasrgh

Sequence, based on observed residues (ATOM records): (download)

>d5ivub_ d.109.1.0 (B:) automated matches {Streptomyces griseoflavus [TaxId: 35619]}
gvtlndacvetyqqlklgkklkyiifhlnkenteiavekssdsvdydnfladlpedecrw
avydleyeagkrnkltfvswapdsakmkqkmayasskdilrraltgiaveiqgtdfseva
henvldkasrgh

SCOPe Domain Coordinates for d5ivub_:

Click to download the PDB-style file with coordinates for d5ivub_.
(The format of our PDB-style files is described here.)

Timeline for d5ivub_:

  • d5ivub_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-30

View in 3D
Domains from other chains:
(mouse over for more information)
d5ivua_