Lineage for d5ivub_ (5ivu B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2188399Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2188400Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2188605Family d.109.1.0: automated matches [191561] (1 protein)
    not a true family
  6. 2188606Protein automated matches [190971] (12 species)
    not a true protein
  7. 2289071Species Streptomyces griseoflavus [TaxId:35619] [332372] (1 PDB entry)
  8. 2289072Domain d5ivub_: 5ivu B: [332373]
    automated match to d1tvja_

Details for d5ivub_

PDB Entry: 5ivu (more details), 2.42 Å

PDB Description: crystal structure of streptomyces griseoflavus cofilin
PDB Compounds: (B:) cofilin

SCOPe Domain Sequences for d5ivub_:

Sequence, based on SEQRES records: (download)

>d5ivub_ d.109.1.0 (B:) automated matches {Streptomyces griseoflavus [TaxId: 35619]}
gvtlndacvetyqqlklgkklkyiifhlnkenteiavekssdsvdydnfladlpedecrw
avydleyekeegagkrnkltfvswapdsakmkqkmayasskdilrraltgiaveiqgtdf
sevahenvldkasrgh

Sequence, based on observed residues (ATOM records): (download)

>d5ivub_ d.109.1.0 (B:) automated matches {Streptomyces griseoflavus [TaxId: 35619]}
gvtlndacvetyqqlklgkklkyiifhlnkenteiavekssdsvdydnfladlpedecrw
avydleyeagkrnkltfvswapdsakmkqkmayasskdilrraltgiaveiqgtdfseva
henvldkasrgh

SCOPe Domain Coordinates for d5ivub_:

Click to download the PDB-style file with coordinates for d5ivub_.
(The format of our PDB-style files is described here.)

Timeline for d5ivub_:

  • d5ivub_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-30

View in 3D
Domains from other chains:
(mouse over for more information)
d5ivua_