SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5iwye_ (5iwy E:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2180205Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2180995Superfamily d.79.5: IpsF-like [69765] (2 families) (S)
    forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2180996Family d.79.5.1: IpsF-like [69766] (3 protein domains)
    automatically mapped to Pfam PF02542
  6. 2181094Protein automated matches [190985] (4 species)
    not a true protein
  7. 2289034Species Bacillus subtilis [TaxId:224308] [332335] (2 PDB entries)
  8. 2289064Domain d5iwye_: 5iwy E: [332365]
    automated match to d1t0aa_
    complexed with c5p, mg

Details for d5iwye_

PDB Entry: 5iwy (more details), 1.99 Å

PDB Description: crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from bacillus subtitis complexed with cmp and mg2+
PDB Compounds: (E:) 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

SCOPe Domain Sequences for d5iwye_:

Sequence, based on SEQRES records: (download)

>d5iwye_ d.79.5.1 (E:) automated matches {Bacillus subtilis [TaxId: 224308]}
mfrigqgfdvhqlvegrpliiggieipyekgllghsdadvllhtvadaclgavgegdigk
hfpdtdpefkdadsfkllqhvwgivkqkgyvlgnidctiiaqkpkmlpyiedmrkriaeg
leadvsqvnvkattteklgftgraegiaaqatvliqkg

Sequence, based on observed residues (ATOM records): (download)

>d5iwye_ d.79.5.1 (E:) automated matches {Bacillus subtilis [TaxId: 224308]}
mfrigqgfdvhqlvegrpliiggieipyekgllghsdadvllhtvadaclgavgegdigk
hfpadsfkllqhvwgivkqkgyvlgnidctiiaqkpkmlpyiedmrkriaegleadvsqv
nvkattteklgftgraegiaaqatvliqkg

SCOPe Domain Coordinates for d5iwye_:

Click to download the PDB-style file with coordinates for d5iwye_.
(The format of our PDB-style files is described here.)

Timeline for d5iwye_:

  • d5iwye_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-30