SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jnta_ (5jnt A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116033Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 2116034Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families) (S)
    share the common active site structure with the family II
  5. 2116035Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (3 protein domains)
    automatically mapped to Pfam PF01451
  6. 2116059Protein Tyrosine phosphatase [52790] (5 species)
  7. 2116076Species Human (Homo sapiens) [TaxId:9606] [52792] (10 PDB entries)
  8. 2289060Domain d5jnta_: 5jnt A: [332361]
    automated match to d5pnta_
    complexed with dms, edo, mes

Details for d5jnta_

PDB Entry: 5jnt (more details), 1.45 Å

PDB Description: crystal structure of human low molecular weight protein tyrosine phosphatase type a (lmptp-a) complexed with mes
PDB Compounds: (A:) Low molecular weight phosphotyrosine protein phosphatase

SCOPe Domain Sequences for d5jnta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jnta_ c.44.1.1 (A:) Tyrosine phosphatase {Human (Homo sapiens) [TaxId: 9606]}
vtksvlfvclgnicrspiaeavfrklvtdqnisenwrvdsaatsgyeignppdyrgqscm
krhgipmshvarqitkedfatfdyilcmdesnlrdlnrksnqvktckakiellgsydpqk
qliiedpyygndsdfetvyqqcvrccraflekah

SCOPe Domain Coordinates for d5jnta_:

Click to download the PDB-style file with coordinates for d5jnta_.
(The format of our PDB-style files is described here.)

Timeline for d5jnta_:

  • d5jnta_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-30