SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5k1vb3 (5k1v B:638-960)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006908Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 2006909Protein automated matches [190220] (14 species)
    not a true protein
  7. 2006934Species Human (Homo sapiens) [TaxId:9606] [189070] (39 PDB entries)
  8. 2289059Domain d5k1vb3: 5k1v B:638-960 [332360]
    Other proteins in same PDB: d5k1va1, d5k1va2, d5k1va3, d5k1va5, d5k1vb1, d5k1vb2
    automated match to d3se6a4
    complexed with 6px, man, nag, zn

Details for d5k1vb3

PDB Entry: 5k1v (more details), 2.9 Å

PDB Description: crystal structure of endoplasmic reticulum aminopeptidase 2 (erap2) in complex with a diaminobenzoic acid derivative ligand.
PDB Compounds: (B:) Endoplasmic reticulum aminopeptidase 2

SCOPe Domain Sequences for d5k1vb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k1vb3 a.118.1.0 (B:638-960) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hgwdqlitqlnqnhtllrpkdrvglihdvfqlvgagrltldkaldmtyylqhetsspall
eglsylesfyhmmdrrnisdisenlkryllqyfkpvidrqswsdkgsvwdrmlrsallkl
acdlnhapciqkaaelfsqwmessgklniptdvlkivysvgaqttagwnylleqyelsms
saeqnkilyalstskhqekllklielgmegkviktqnlaallhaiarrpkgqqlawdfvr
enwthllkkfdlgsydirmiisgttahfsskdklqevklffesleaqgshldifqtvlet
itknikwleknlptlrtwlmvnt

SCOPe Domain Coordinates for d5k1vb3:

Click to download the PDB-style file with coordinates for d5k1vb3.
(The format of our PDB-style files is described here.)

Timeline for d5k1vb3:

  • d5k1vb3 appears in periodic updates to SCOPe 2.06 starting on 2017-03-30