Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) |
Family d.92.1.0: automated matches [191495] (1 protein) not a true family |
Protein automated matches [190805] (20 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188286] (69 PDB entries) |
Domain d5k1vb2: 5k1v B:272-546 [332359] Other proteins in same PDB: d5k1va1, d5k1va3, d5k1va4, d5k1va5, d5k1vb1, d5k1vb3 automated match to d3se6a2 complexed with 6px, nag, zn |
PDB Entry: 5k1v (more details), 2.9 Å
SCOPe Domain Sequences for d5k1vb2:
Sequence, based on SEQRES records: (download)
>d5k1vb2 d.92.1.0 (B:272-546) automated matches {Human (Homo sapiens) [TaxId: 9606]} hslsgftssgvkvsiyaspdkrnqthyalqaslklldfyekyfdiyyplskldliaipdf apgamenwglityretsllfdpktssasdklwvtrviahelahqwfgnlvtmewwndiwl kegfakymeliavnatypelqfddyflnvcfevitkdslnssrpiskpaetptqiqemfd evsynkgacilnmlkdflgeekfqkgiiqylkkfsyrnaknddlwsslsnsclesdftsg gvchsdpkmtsnmlaflgenaevkemmttwtlqkg
>d5k1vb2 d.92.1.0 (B:272-546) automated matches {Human (Homo sapiens) [TaxId: 9606]} hslsgftssgvkvsiyaspdkrnqthyalqaslklldfyekyfdiyyplskldliaipdf apgamenwglityretsllfdpktssasdklwvtrviahelahqwfgnlvtmewwndiwl kegfakymeliavnatypelqfddyflnvcfevitkdslnssrpiskpaetptqiqemfd evsynkgacilnmlkdflgeekfqkgiiqylkkfsyrnaknddlwsslsngenaevkemm ttwtlqkg
Timeline for d5k1vb2: