SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5k1vb2 (5k1v B:272-546)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2183652Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2183653Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2184728Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2184729Protein automated matches [190805] (16 species)
    not a true protein
  7. 2184748Species Human (Homo sapiens) [TaxId:9606] [188286] (40 PDB entries)
  8. 2289058Domain d5k1vb2: 5k1v B:272-546 [332359]
    Other proteins in same PDB: d5k1va1, d5k1va3, d5k1va4, d5k1va5, d5k1vb1, d5k1vb3
    automated match to d3se6a2
    complexed with 6px, man, nag, zn

Details for d5k1vb2

PDB Entry: 5k1v (more details), 2.9 Å

PDB Description: crystal structure of endoplasmic reticulum aminopeptidase 2 (erap2) in complex with a diaminobenzoic acid derivative ligand.
PDB Compounds: (B:) Endoplasmic reticulum aminopeptidase 2

SCOPe Domain Sequences for d5k1vb2:

Sequence, based on SEQRES records: (download)

>d5k1vb2 d.92.1.0 (B:272-546) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hslsgftssgvkvsiyaspdkrnqthyalqaslklldfyekyfdiyyplskldliaipdf
apgamenwglityretsllfdpktssasdklwvtrviahelahqwfgnlvtmewwndiwl
kegfakymeliavnatypelqfddyflnvcfevitkdslnssrpiskpaetptqiqemfd
evsynkgacilnmlkdflgeekfqkgiiqylkkfsyrnaknddlwsslsnsclesdftsg
gvchsdpkmtsnmlaflgenaevkemmttwtlqkg

Sequence, based on observed residues (ATOM records): (download)

>d5k1vb2 d.92.1.0 (B:272-546) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hslsgftssgvkvsiyaspdkrnqthyalqaslklldfyekyfdiyyplskldliaipdf
apgamenwglityretsllfdpktssasdklwvtrviahelahqwfgnlvtmewwndiwl
kegfakymeliavnatypelqfddyflnvcfevitkdslnssrpiskpaetptqiqemfd
evsynkgacilnmlkdflgeekfqkgiiqylkkfsyrnaknddlwsslsngenaevkemm
ttwtlqkg

SCOPe Domain Coordinates for d5k1vb2:

Click to download the PDB-style file with coordinates for d5k1vb2.
(The format of our PDB-style files is described here.)

Timeline for d5k1vb2:

  • d5k1vb2 appears in periodic updates to SCOPe 2.06 starting on 2017-03-30