SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5k1vb1 (5k1v B:54-271)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2074640Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
    duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain
  4. 2074641Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) (S)
  5. 2074713Family b.98.1.0: automated matches [254305] (1 protein)
    not a true family
  6. 2074714Protein automated matches [254706] (5 species)
    not a true protein
  7. 2074718Species Human (Homo sapiens) [TaxId:9606] [255964] (16 PDB entries)
  8. 2289057Domain d5k1vb1: 5k1v B:54-271 [332358]
    Other proteins in same PDB: d5k1va2, d5k1va3, d5k1va4, d5k1va5, d5k1vb2, d5k1vb3
    automated match to d3se6a1
    complexed with 6px, man, nag, zn

Details for d5k1vb1

PDB Entry: 5k1v (more details), 2.9 Å

PDB Description: crystal structure of endoplasmic reticulum aminopeptidase 2 (erap2) in complex with a diaminobenzoic acid derivative ligand.
PDB Compounds: (B:) Endoplasmic reticulum aminopeptidase 2

SCOPe Domain Sequences for d5k1vb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k1vb1 b.98.1.0 (B:54-271) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvatngerfpwqelrlpsvviplhydlfvhpnltsldfvasekievlvsnatqfiilhsk
dleitnatlqseedsrymkpgkelkvlsypaheqiallvpekltphlkyyvamdfqaklg
dgfegfykstyrtlggetrilavtdfeptqarmafpcfdeplfkanfsikirresrhial
snmpkvktielegglledhfettvkmstylvayivcdf

SCOPe Domain Coordinates for d5k1vb1:

Click to download the PDB-style file with coordinates for d5k1vb1.
(The format of our PDB-style files is described here.)

Timeline for d5k1vb1:

  • d5k1vb1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-30