Lineage for d5k1vb1 (5k1v B:54-271)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2074640Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
    duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain
  4. 2074641Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) (S)
  5. 2074713Family b.98.1.0: automated matches [254305] (1 protein)
    not a true family
  6. 2074714Protein automated matches [254706] (5 species)
    not a true protein
  7. 2074718Species Human (Homo sapiens) [TaxId:9606] [255964] (16 PDB entries)
  8. 2289057Domain d5k1vb1: 5k1v B:54-271 [332358]
    Other proteins in same PDB: d5k1va2, d5k1va3, d5k1va4, d5k1va5, d5k1vb2, d5k1vb3
    automated match to d3se6a1
    complexed with 6px, man, nag, zn

Details for d5k1vb1

PDB Entry: 5k1v (more details), 2.9 Å

PDB Description: crystal structure of endoplasmic reticulum aminopeptidase 2 (erap2) in complex with a diaminobenzoic acid derivative ligand.
PDB Compounds: (B:) Endoplasmic reticulum aminopeptidase 2

SCOPe Domain Sequences for d5k1vb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k1vb1 b.98.1.0 (B:54-271) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvatngerfpwqelrlpsvviplhydlfvhpnltsldfvasekievlvsnatqfiilhsk
dleitnatlqseedsrymkpgkelkvlsypaheqiallvpekltphlkyyvamdfqaklg
dgfegfykstyrtlggetrilavtdfeptqarmafpcfdeplfkanfsikirresrhial
snmpkvktielegglledhfettvkmstylvayivcdf

SCOPe Domain Coordinates for d5k1vb1:

Click to download the PDB-style file with coordinates for d5k1vb1.
(The format of our PDB-style files is described here.)

Timeline for d5k1vb1:

  • d5k1vb1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-30