Lineage for d5k4hb_ (5k4h B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142620Fold c.88: Glutaminase/Asparaginase [53773] (1 superfamily)
    consists of two non-similar alpha/beta domains, 3 layers (a/b/a) each
    Domain 1 has mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest; left-handed crossover connection between strands 4 and 5
    Domain 2 has parallel beta-sheet of 4 strands, order 1234
  4. 2142621Superfamily c.88.1: Glutaminase/Asparaginase [53774] (2 families) (S)
  5. 2142622Family c.88.1.1: Glutaminase/Asparaginase [53775] (4 protein domains)
    automatically mapped to Pfam PF00710
  6. 2142623Protein Asparaginase type II [53776] (5 species)
  7. 2289052Species Wolinella succinogenes [TaxId:273121] [332353] (4 PDB entries)
  8. 2289054Domain d5k4hb_: 5k4h B: [332355]
    automated match to d1wsaa_
    complexed with glu

Details for d5k4hb_

PDB Entry: 5k4h (more details), 2 Å

PDB Description: wolinella succinogenes l-asparaginase s121 + l-glutamic acid
PDB Compounds: (B:) L-asparaginase

SCOPe Domain Sequences for d5k4hb_:

Sequence, based on SEQRES records: (download)

>d5k4hb_ c.88.1.1 (B:) Asparaginase type II {Wolinella succinogenes [TaxId: 273121]}
kpqvtilatggtiagsgessvkssysagavtvdkllaavpaindlatikgeqissigsqe
mtgkvwlklakrvnellaqketeaviithgtdtmeetafflnltvksqkpvvlvgamrsg
ssmsadgpmnlynavnvainkastnkgvvivmndeihaareatklnttavnafaspntgk
igtvyygkveyftqsvrphtlasefdiskieelprvdilyahpddtdvlvnaalqagakg
iihagmgngnpfpltqnalekaaksgvvvarssrvgsgsttqeaevddkklgfvatesln
pqkarvllmlaltktsdreaiqkifsty

Sequence, based on observed residues (ATOM records): (download)

>d5k4hb_ c.88.1.1 (B:) Asparaginase type II {Wolinella succinogenes [TaxId: 273121]}
kpqvtilatggtiagsysagavtvdkllaavpaindlatikgeqissigsqemtgkvwlk
lakrvnellaqketeaviithgtdtmeetafflnltvksqkpvvlvgamrsgssmsadgp
mnlynavnvainkastnkgvvivmndeihaareatklnttavnafaspntgkigtvyygk
veyftqsvrphtlasefdiskieelprvdilyahpddtdvlvnaalqagakgiihagmgn
gnpfpltqnalekaaksgvvvarssrvgsgsttqeaevddkklgfvateslnpqkarvll
mlaltktsdreaiqkifsty

SCOPe Domain Coordinates for d5k4hb_:

Click to download the PDB-style file with coordinates for d5k4hb_.
(The format of our PDB-style files is described here.)

Timeline for d5k4hb_:

  • d5k4hb_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-30