SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5k4gd_ (5k4g D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142620Fold c.88: Glutaminase/Asparaginase [53773] (1 superfamily)
    consists of two non-similar alpha/beta domains, 3 layers (a/b/a) each
    Domain 1 has mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest; left-handed crossover connection between strands 4 and 5
    Domain 2 has parallel beta-sheet of 4 strands, order 1234
  4. 2142621Superfamily c.88.1: Glutaminase/Asparaginase [53774] (2 families) (S)
  5. 2142622Family c.88.1.1: Glutaminase/Asparaginase [53775] (4 protein domains)
    automatically mapped to Pfam PF00710
  6. 2142708Protein automated matches [190446] (8 species)
    not a true protein
  7. 2289049Species Wolinella succinogenes [TaxId:273121] [332350] (1 PDB entry)
  8. 2289051Domain d5k4gd_: 5k4g D: [332352]
    Other proteins in same PDB: d5k4ga_, d5k4gc_
    automated match to d1wsaa_
    complexed with asp

Details for d5k4gd_

PDB Entry: 5k4g (more details), 1.6 Å

PDB Description: wolinella succinogenes l-asparaginase s121 + l-aspartic acid, open conformation
PDB Compounds: (D:) L-asparaginase

SCOPe Domain Sequences for d5k4gd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k4gd_ c.88.1.1 (D:) automated matches {Wolinella succinogenes [TaxId: 273121]}
kpqvtilatggtiagsgessvkssysagavtvdkllaavpaindlatikgeqissigsqe
mtgkvwlklakrvnellaqketeaviithgtdtmeetafflnltvksqkpvvlvgamrsg
ssmsadgpmnlynavnvainkastnkgvvivmndeihaareatklnttavnafaspntgk
igtvyygkveyftqsvrphtlasefdiskieelprvdilyahpddtdvlvnaalqagakg
iihagmgngnpfpltqnalekaaksgvvvarssrvgsgsttqeaevddkklgfvatesln
pqkarvllmlaltktsdreaiqkifsty

SCOPe Domain Coordinates for d5k4gd_:

Click to download the PDB-style file with coordinates for d5k4gd_.
(The format of our PDB-style files is described here.)

Timeline for d5k4gd_:

  • d5k4gd_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-30