Lineage for d5k4gb_ (5k4g B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142620Fold c.88: Glutaminase/Asparaginase [53773] (1 superfamily)
    consists of two non-similar alpha/beta domains, 3 layers (a/b/a) each
    Domain 1 has mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest; left-handed crossover connection between strands 4 and 5
    Domain 2 has parallel beta-sheet of 4 strands, order 1234
  4. 2142621Superfamily c.88.1: Glutaminase/Asparaginase [53774] (2 families) (S)
  5. 2142622Family c.88.1.1: Glutaminase/Asparaginase [53775] (4 protein domains)
    automatically mapped to Pfam PF00710
  6. 2142708Protein automated matches [190446] (8 species)
    not a true protein
  7. 2289049Species Wolinella succinogenes [TaxId:273121] [332350] (1 PDB entry)
  8. 2289050Domain d5k4gb_: 5k4g B: [332351]
    Other proteins in same PDB: d5k4ga_, d5k4gc_
    automated match to d1wsaa_
    complexed with asp

Details for d5k4gb_

PDB Entry: 5k4g (more details), 1.6 Å

PDB Description: wolinella succinogenes l-asparaginase s121 + l-aspartic acid, open conformation
PDB Compounds: (B:) L-asparaginase

SCOPe Domain Sequences for d5k4gb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k4gb_ c.88.1.1 (B:) automated matches {Wolinella succinogenes [TaxId: 273121]}
kpqvtilatggtiagsgessvkssysagavtvdkllaavpaindlatikgeqissigsqe
mtgkvwlklakrvnellaqketeaviithgtdtmeetafflnltvksqkpvvlvgamrsg
ssmsadgpmnlynavnvainkastnkgvvivmndeihaareatklnttavnafaspntgk
igtvyygkveyftqsvrphtlasefdiskieelprvdilyahpddtdvlvnaalqagakg
iihagmgngnpfpltqnalekaaksgvvvarssrvgsgsttqeaevddkklgfvatesln
pqkarvllmlaltktsdreaiqkifsty

SCOPe Domain Coordinates for d5k4gb_:

Click to download the PDB-style file with coordinates for d5k4gb_.
(The format of our PDB-style files is described here.)

Timeline for d5k4gb_:

  • d5k4gb_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-30