Lineage for d5jnub_ (5jnu B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2874827Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 2874828Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families) (S)
    share the common active site structure with the family II
  5. 2874829Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (3 proteins)
    automatically mapped to Pfam PF01451
  6. 2874853Protein Tyrosine phosphatase [52790] (5 species)
  7. 2874887Species Mouse (Mus musculus) [TaxId:10090] [187979] (2 PDB entries)
  8. 2874893Domain d5jnub_: 5jnu B: [332349]
    automated match to d5pnta_
    complexed with po4

Details for d5jnub_

PDB Entry: 5jnu (more details), 2.54 Å

PDB Description: crystal structure of mouse low-molecular weight protein tyrosine phosphatase type a (lmptp-a) complexed with phosphate
PDB Compounds: (B:) Low molecular weight phosphotyrosine protein phosphatase

SCOPe Domain Sequences for d5jnub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jnub_ c.44.1.1 (B:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]}
gsksvlfvclgnicrspiaeavfrklvtdekvsdnwridsaatstyevgnppdyrgqncm
rkhgihmqhiarqitkedfatfdyilcmdesnlrdlnrksnqvknckakiellgsydpqk
qliiedpyygndsdfevvyqqclrcckaflekt

SCOPe Domain Coordinates for d5jnub_:

Click to download the PDB-style file with coordinates for d5jnub_.
(The format of our PDB-style files is described here.)

Timeline for d5jnub_: