SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5j1ra1 (5j1r A:22-94)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1981148Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1981577Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 protein domains)
  6. 1981584Protein Ethr repressor [109651] (2 species)
  7. 1981585Species Mycobacterium tuberculosis [TaxId:1773] [109652] (14 PDB entries)
    Uniprot P96222 22-215
  8. 2289045Domain d5j1ra1: 5j1r A:22-94 [332346]
    Other proteins in same PDB: d5j1ra2
    automated match to d1t56a1
    complexed with 6fg

Details for d5j1ra1

PDB Entry: 5j1r (more details), 1.92 Å

PDB Description: structure of transcriptional regulatory repressor protein - ethr from mycobacterium tuberculosis in complex with 3-(furan-3-yl)-1- (pyrrolidin-1-yl)propan-1-one at 1.92a resolution
PDB Compounds: (A:) EthR

SCOPe Domain Sequences for d5j1ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j1ra1 a.4.1.9 (A:22-94) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
gddrelailataenlledrpladisvddlakgagisrptfyfyfpskeavlltlldrvvn
qadmalqtlaenp

SCOPe Domain Coordinates for d5j1ra1:

Click to download the PDB-style file with coordinates for d5j1ra1.
(The format of our PDB-style files is described here.)

Timeline for d5j1ra1:

  • d5j1ra1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-30

View in 3D
Domains from same chain:
(mouse over for more information)
d5j1ra2