Lineage for d5iw1c1 (5iw1 C:3-116)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2019432Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 2019537Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (22 PDB entries)
  8. 2289042Domain d5iw1c1: 5iw1 C:3-116 [332343]
    Other proteins in same PDB: d5iw1a1, d5iw1a2, d5iw1b1, d5iw1b2, d5iw1c2, d5iw1d1, d5iw1d2, d5iw1e1, d5iw1e2, d5iw1f1, d5iw1f2
    automated match to d1tcra1

Details for d5iw1c1

PDB Entry: 5iw1 (more details), 3 Å

PDB Description: crystal structure of b4.2.3 t-cell receptor
PDB Compounds: (C:) T-cell receptor alpha chain

SCOPe Domain Sequences for d5iw1c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iw1c1 b.1.1.1 (C:3-116) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]}
qqvrqspqsltvwegetailncsyensafdyfpwyqqfpgegpallisilsvsnkkedgr
ftiffnkrekklslhiadsqpgdsatyfcaasasfgdnskliwglgtslvvnpn

SCOPe Domain Coordinates for d5iw1c1:

Click to download the PDB-style file with coordinates for d5iw1c1.
(The format of our PDB-style files is described here.)

Timeline for d5iw1c1:

  • d5iw1c1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-30