SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5iw1c1 (5iw1 C:3-116)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2019432Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 2019537Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (22 PDB entries)
  8. 2289042Domain d5iw1c1: 5iw1 C:3-116 [332343]
    Other proteins in same PDB: d5iw1a1, d5iw1a2, d5iw1b1, d5iw1b2, d5iw1c2, d5iw1d1, d5iw1d2, d5iw1e1, d5iw1e2, d5iw1f1, d5iw1f2
    automated match to d1tcra1

Details for d5iw1c1

PDB Entry: 5iw1 (more details), 3 Å

PDB Description: crystal structure of b4.2.3 t-cell receptor
PDB Compounds: (C:) T-cell receptor alpha chain

SCOPe Domain Sequences for d5iw1c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iw1c1 b.1.1.1 (C:3-116) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]}
qqvrqspqsltvwegetailncsyensafdyfpwyqqfpgegpallisilsvsnkkedgr
ftiffnkrekklslhiadsqpgdsatyfcaasasfgdnskliwglgtslvvnpn

SCOPe Domain Coordinates for d5iw1c1:

Click to download the PDB-style file with coordinates for d5iw1c1.
(The format of our PDB-style files is described here.)

Timeline for d5iw1c1:

  • d5iw1c1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-30