Lineage for d5ioya2 (5ioy A:95-214)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008141Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2008142Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2008143Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 protein domains)
  6. 2008150Protein Ethr repressor [109978] (2 species)
  7. 2289040Species Mycobacterium tuberculosis [TaxId:419947] [332341] (4 PDB entries)
  8. 2289041Domain d5ioya2: 5ioy A:95-214 [332342]
    Other proteins in same PDB: d5ioya1
    automated match to d1t56a2
    complexed with 6c5, so4

Details for d5ioya2

PDB Entry: 5ioy (more details), 1.77 Å

PDB Description: structure of transcriptional regulatory repressor protein - ethr from mycobacterium tuberculosis in complex with n-(cyclopentylmethyl) pyrrolidine-1-carboxamide at 1.77a resolution
PDB Compounds: (A:) TetR-family transcriptional regulatory repressor protein

SCOPe Domain Sequences for d5ioya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ioya2 a.121.1.1 (A:95-214) Ethr repressor {Mycobacterium tuberculosis [TaxId: 419947]}
adtdrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavid
aerdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge

SCOPe Domain Coordinates for d5ioya2:

Click to download the PDB-style file with coordinates for d5ioya2.
(The format of our PDB-style files is described here.)

Timeline for d5ioya2:

  • d5ioya2 appears in periodic updates to SCOPe 2.06 starting on 2017-03-30

View in 3D
Domains from same chain:
(mouse over for more information)
d5ioya1