Lineage for d5ioya1 (5ioy A:22-94)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1981148Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1981577Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 protein domains)
  6. 1981584Protein Ethr repressor [109651] (2 species)
  7. 2289038Species Mycobacterium tuberculosis [TaxId:419947] [332339] (4 PDB entries)
  8. 2289039Domain d5ioya1: 5ioy A:22-94 [332340]
    Other proteins in same PDB: d5ioya2
    automated match to d1t56a1
    complexed with 6c5, so4

Details for d5ioya1

PDB Entry: 5ioy (more details), 1.77 Å

PDB Description: structure of transcriptional regulatory repressor protein - ethr from mycobacterium tuberculosis in complex with n-(cyclopentylmethyl) pyrrolidine-1-carboxamide at 1.77a resolution
PDB Compounds: (A:) TetR-family transcriptional regulatory repressor protein

SCOPe Domain Sequences for d5ioya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ioya1 a.4.1.9 (A:22-94) Ethr repressor {Mycobacterium tuberculosis [TaxId: 419947]}
gddrelailataenlledrpladisvddlakgagisrptfyfyfpskeavlltlldrvvn
qadmalqtlaenp

SCOPe Domain Coordinates for d5ioya1:

Click to download the PDB-style file with coordinates for d5ioya1.
(The format of our PDB-style files is described here.)

Timeline for d5ioya1:

  • d5ioya1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-30

View in 3D
Domains from same chain:
(mouse over for more information)
d5ioya2