SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ipzc_ (5ipz C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2067964Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2067965Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2067966Family b.74.1.1: Carbonic anhydrase [51070] (2 protein domains)
    automatically mapped to Pfam PF00194
  6. 2068653Protein automated matches [190681] (2 species)
    not a true protein
  7. 2068663Species Human (Homo sapiens) [TaxId:9606] [187805] (27 PDB entries)
  8. 2289037Domain d5ipzc_: 5ipz C: [332338]
    automated match to d3d0na_
    complexed with 6cc, zn

Details for d5ipzc_

PDB Entry: 5ipz (more details), 2.1 Å

PDB Description: crystal structure of human carbonic anhydrase isozyme iv with 5-(2- amino-1,3-thiazol-4-yl)-2-chlorobenzenesulfonamide
PDB Compounds: (C:) Carbonic anhydrase 4

SCOPe Domain Sequences for d5ipzc_:

Sequence, based on SEQRES records: (download)

>d5ipzc_ b.74.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eshwcyevqaessnypclvpvkwggncqkdrqspinivttkakvdkklgrfffsgydkkq
twtvqnnghsvmmllenkasisggglpapyqakqlhlhwsdlpykgsehsldgehfamem
hivhekekgtsrnvkeaqdpedeiavlaflveagtqvnegfqplvealsnipkpemsttm
aesslldllpkeeklrhyfrylgslttptcdekvvwtvfrepiqlhreqilafsqklyyd
keqtvsmkdnvrplqqlgqrtviks

Sequence, based on observed residues (ATOM records): (download)

>d5ipzc_ b.74.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eshwcyevqaessnypclvpvkwggncqkdrqspinivttkakvdkklgrfffsgydkkq
twtvqnnghsvmmllenkasisggglpapyqakqlhlhwsdlpykgsehsldgehfamem
hivhekekgpedeiavlaflveagtqvnegfqplvealsnipkpemsttmaesslldllp
keeklrhyfrylgslttptcdekvvwtvfrepiqlhreqilafsqklyydkeqtvsmkdn
vrplqqlgqrtviks

SCOPe Domain Coordinates for d5ipzc_:

Click to download the PDB-style file with coordinates for d5ipzc_.
(The format of our PDB-style files is described here.)

Timeline for d5ipzc_:

  • d5ipzc_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-30