Lineage for d5ipzc_ (5ipz C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2067964Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2067965Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2067966Family b.74.1.1: Carbonic anhydrase [51070] (2 protein domains)
    automatically mapped to Pfam PF00194
  6. 2068653Protein automated matches [190681] (2 species)
    not a true protein
  7. 2068663Species Human (Homo sapiens) [TaxId:9606] [187805] (29 PDB entries)
  8. 2289037Domain d5ipzc_: 5ipz C: [332338]
    automated match to d3d0na_
    complexed with 6cc, zn

Details for d5ipzc_

PDB Entry: 5ipz (more details), 2.1 Å

PDB Description: crystal structure of human carbonic anhydrase isozyme iv with 5-(2- amino-1,3-thiazol-4-yl)-2-chlorobenzenesulfonamide
PDB Compounds: (C:) Carbonic anhydrase 4

SCOPe Domain Sequences for d5ipzc_:

Sequence, based on SEQRES records: (download)

>d5ipzc_ b.74.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eshwcyevqaessnypclvpvkwggncqkdrqspinivttkakvdkklgrfffsgydkkq
twtvqnnghsvmmllenkasisggglpapyqakqlhlhwsdlpykgsehsldgehfamem
hivhekekgtsrnvkeaqdpedeiavlaflveagtqvnegfqplvealsnipkpemsttm
aesslldllpkeeklrhyfrylgslttptcdekvvwtvfrepiqlhreqilafsqklyyd
keqtvsmkdnvrplqqlgqrtviks

Sequence, based on observed residues (ATOM records): (download)

>d5ipzc_ b.74.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eshwcyevqaessnypclvpvkwggncqkdrqspinivttkakvdkklgrfffsgydkkq
twtvqnnghsvmmllenkasisggglpapyqakqlhlhwsdlpykgsehsldgehfamem
hivhekekgpedeiavlaflveagtqvnegfqplvealsnipkpemsttmaesslldllp
keeklrhyfrylgslttptcdekvvwtvfrepiqlhreqilafsqklyydkeqtvsmkdn
vrplqqlgqrtviks

SCOPe Domain Coordinates for d5ipzc_:

Click to download the PDB-style file with coordinates for d5ipzc_.
(The format of our PDB-style files is described here.)

Timeline for d5ipzc_:

  • d5ipzc_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-30