Lineage for d5ipzd_ (5ipz D:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2401367Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2401368Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2401369Family b.74.1.1: Carbonic anhydrase [51070] (2 protein domains)
    automatically mapped to Pfam PF00194
  6. 2401370Protein Carbonic anhydrase [51071] (10 species)
  7. 2402119Species Human (Homo sapiens), isozyme IV [TaxId:9606] [51076] (10 PDB entries)
  8. 2402153Domain d5ipzd_: 5ipz D: [332331]
    automated match to d3d0na_
    complexed with 6cc, zn

Details for d5ipzd_

PDB Entry: 5ipz (more details), 2.1 Å

PDB Description: crystal structure of human carbonic anhydrase isozyme iv with 5-(2- amino-1,3-thiazol-4-yl)-2-chlorobenzenesulfonamide
PDB Compounds: (D:) Carbonic anhydrase 4

SCOPe Domain Sequences for d5ipzd_:

Sequence, based on SEQRES records: (download)

>d5ipzd_ b.74.1.1 (D:) Carbonic anhydrase {Human (Homo sapiens), isozyme IV [TaxId: 9606]}
hwcyevqaessnypclvpvkwggncqkdrqspinivttkakvdkklgrfffsgydkkqtw
tvqnnghsvmmllenkasisggglpapyqakqlhlhwsdlpykgsehsldgehfamemhi
vhekekgtsrnvkeaqdpedeiavlaflveagtqvnegfqplvealsnipkpemsttmae
sslldllpkeeklrhyfrylgslttptcdekvvwtvfrepiqlhreqilafsqklyydke
qtvsmkdnvrplqqlgqrtviks

Sequence, based on observed residues (ATOM records): (download)

>d5ipzd_ b.74.1.1 (D:) Carbonic anhydrase {Human (Homo sapiens), isozyme IV [TaxId: 9606]}
hwcyevqaessnypclvpvkwggncqkdrqspinivttkakvdkklgrfffsgydkkqtw
tvqnnghsvmmllenkasisggglpapyqakqlhlhwsdlpykgsehsldgehfamemhi
vhekekgpedeiavlaflveagtqvnegfqplvealsnipkpemsttmaesslldllpke
eklrhyfrylgslttptcdekvvwtvfrepiqlhreqilafsqklyydkeqtvsmkdnvr
plqqlgqrtviks

SCOPe Domain Coordinates for d5ipzd_:

Click to download the PDB-style file with coordinates for d5ipzd_.
(The format of our PDB-style files is described here.)

Timeline for d5ipzd_: