Lineage for d5gu2x_ (5gu2 X:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1988415Family a.25.1.1: Ferritin [47241] (10 protein domains)
  6. 1988416Protein (Apo)ferritin [47246] (8 species)
  7. 1988470Species Horse (Equus caballus), L chain [TaxId:9796] [47248] (65 PDB entries)
  8. 2289028Domain d5gu2x_: 5gu2 X: [332329]
    automated match to d3nozx_
    complexed with au, cd, edo, so4

Details for d5gu2x_

PDB Entry: 5gu2 (more details), 2.12 Å

PDB Description: crystal structure of au(m).cl-apo-e45c/r52c-rhlfr
PDB Compounds: (X:) ferritin light chain

SCOPe Domain Sequences for d5gu2x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gu2x_ a.25.1.1 (X:) (Apo)ferritin {Horse (Equus caballus), L chain [TaxId: 9796]}
qirqnysteveaavnrlvnlylrasytylslgfyfdrddvalcgvchffcelaeekrega
erllkmqnqrggralfqdlqkpsqdewgttldamkaaivlekslnqalldlhalgsaqad
phlcdfleshfldeevklikkmgdhltniqrlvgsqaglgeylferltl

SCOPe Domain Coordinates for d5gu2x_:

Click to download the PDB-style file with coordinates for d5gu2x_.
(The format of our PDB-style files is described here.)

Timeline for d5gu2x_:

  • d5gu2x_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-30