SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5gu2x_ (5gu2 X:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1988415Family a.25.1.1: Ferritin [47241] (10 protein domains)
  6. 1988416Protein (Apo)ferritin [47246] (8 species)
  7. 1988470Species Horse (Equus caballus), L chain [TaxId:9796] [47248] (65 PDB entries)
  8. 2289028Domain d5gu2x_: 5gu2 X: [332329]
    automated match to d3nozx_
    complexed with au, cd, edo, so4

Details for d5gu2x_

PDB Entry: 5gu2 (more details), 2.12 Å

PDB Description: crystal structure of au(m).cl-apo-e45c/r52c-rhlfr
PDB Compounds: (X:) ferritin light chain

SCOPe Domain Sequences for d5gu2x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gu2x_ a.25.1.1 (X:) (Apo)ferritin {Horse (Equus caballus), L chain [TaxId: 9796]}
qirqnysteveaavnrlvnlylrasytylslgfyfdrddvalcgvchffcelaeekrega
erllkmqnqrggralfqdlqkpsqdewgttldamkaaivlekslnqalldlhalgsaqad
phlcdfleshfldeevklikkmgdhltniqrlvgsqaglgeylferltl

SCOPe Domain Coordinates for d5gu2x_:

Click to download the PDB-style file with coordinates for d5gu2x_.
(The format of our PDB-style files is described here.)

Timeline for d5gu2x_:

  • d5gu2x_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-30