SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5gk9a_ (5gk9 A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2187564Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2187565Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2187566Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 protein domains)
  6. 2187911Protein automated matches [190241] (12 species)
    not a true protein
  7. 2187930Species Human (Homo sapiens) [TaxId:9606] [187321] (10 PDB entries)
  8. 2289026Domain d5gk9a_: 5gk9 A: [332327]
    automated match to d4dnca_
    complexed with aco, zn

Details for d5gk9a_

PDB Entry: 5gk9 (more details), 2.4 Å

PDB Description: crystal structure of human hbo1 in complex with brpf2
PDB Compounds: (A:) Histone acetyltransferase KAT7

SCOPe Domain Sequences for d5gk9a_:

Sequence, based on SEQRES records: (download)

>d5gk9a_ d.108.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
miktiafgryeldtwyhspypeeyarlgrlymcefclkymksqtilrrhmakcvwkhppg
deiyrkgsisvfevdgkknkiycqnlcllaklfldhktlyydvepflfyvmteadntgch
ligyfskeknsflnynvsciltmpqymrqgygkmlidfsyllskveekvgsperplsdlg
lisyrsywkevllrylhnfqgkeisikeisqetavnpvdivstlqalqmlkywkgkhlvl
krqdlidewiakeakrsnsnktmdpsclkwtpp

Sequence, based on observed residues (ATOM records): (download)

>d5gk9a_ d.108.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
miktiafgryeldtwyhspypeeyarlgrlymcefclkymksqtilrrhmakcvwkhppg
deiyrkgsisvfevdgkknkiycqnlcllaklfldhktlyydvepflfyvmteadntgch
ligyfskeknsflnynvsciltmpqymrqgygkmlidfsyllskveekvgsperplsdlg
lisyrsywkevllrylhnfqgkeisikeisqetavnpvdivstlqalqmlkywkgkhlvl
krqdlidewisnktmdpsclkwtpp

SCOPe Domain Coordinates for d5gk9a_:

Click to download the PDB-style file with coordinates for d5gk9a_.
(The format of our PDB-style files is described here.)

Timeline for d5gk9a_:

  • d5gk9a_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-30