Lineage for d5gk9a_ (5gk9 A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2187564Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2187565Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2187566Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 protein domains)
  6. 2187911Protein automated matches [190241] (12 species)
    not a true protein
  7. 2187930Species Human (Homo sapiens) [TaxId:9606] [187321] (10 PDB entries)
  8. 2289026Domain d5gk9a_: 5gk9 A: [332327]
    automated match to d4dnca_
    complexed with aco, zn

Details for d5gk9a_

PDB Entry: 5gk9 (more details), 2.4 Å

PDB Description: crystal structure of human hbo1 in complex with brpf2
PDB Compounds: (A:) Histone acetyltransferase KAT7

SCOPe Domain Sequences for d5gk9a_:

Sequence, based on SEQRES records: (download)

>d5gk9a_ d.108.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
miktiafgryeldtwyhspypeeyarlgrlymcefclkymksqtilrrhmakcvwkhppg
deiyrkgsisvfevdgkknkiycqnlcllaklfldhktlyydvepflfyvmteadntgch
ligyfskeknsflnynvsciltmpqymrqgygkmlidfsyllskveekvgsperplsdlg
lisyrsywkevllrylhnfqgkeisikeisqetavnpvdivstlqalqmlkywkgkhlvl
krqdlidewiakeakrsnsnktmdpsclkwtpp

Sequence, based on observed residues (ATOM records): (download)

>d5gk9a_ d.108.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
miktiafgryeldtwyhspypeeyarlgrlymcefclkymksqtilrrhmakcvwkhppg
deiyrkgsisvfevdgkknkiycqnlcllaklfldhktlyydvepflfyvmteadntgch
ligyfskeknsflnynvsciltmpqymrqgygkmlidfsyllskveekvgsperplsdlg
lisyrsywkevllrylhnfqgkeisikeisqetavnpvdivstlqalqmlkywkgkhlvl
krqdlidewisnktmdpsclkwtpp

SCOPe Domain Coordinates for d5gk9a_:

Click to download the PDB-style file with coordinates for d5gk9a_.
(The format of our PDB-style files is described here.)

Timeline for d5gk9a_:

  • d5gk9a_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-30