Lineage for d5flka1 (5flk A:4-293)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2134682Family c.69.1.8: Haloalkane dehalogenase [53513] (2 protein domains)
  6. 2134722Protein automated matches [190880] (5 species)
    not a true protein
  7. 2134728Species Rhodococcus rhodochrous [TaxId:1829] [189127] (14 PDB entries)
  8. 2289025Domain d5flka1: 5flk A:4-293 [332326]
    Other proteins in same PDB: d5flka2
    automated match to d2v9za_
    complexed with mes, peg

Details for d5flka1

PDB Entry: 5flk (more details), 0.99 Å

PDB Description: structure of haloalkane dehalogenase variant dhaa101
PDB Compounds: (A:) dhaa101

SCOPe Domain Sequences for d5flka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5flka1 c.69.1.8 (A:4-293) automated matches {Rhodococcus rhodochrous [TaxId: 1829]}
igtgfpfdphyvevlgsrmhyvdvgprdgtpvlflhgnptssylwrniiphvapshrcia
pdligmgksdkpdldyrfddhvryldafiealgleevvlvihdwgsalgfhwakrnperv
kgiacmefirpiptwdewpefaretfqafrtpdvgreliidqnafiegalpkcvvrplte
vemdhyrepflkpvdreplwrfpnelpiagepanivalveaymnwlhqspvpkllfwgtp
gvlippaeaarlaeslpncktvdigpglhylqednpdligseiarwlpal

SCOPe Domain Coordinates for d5flka1:

Click to download the PDB-style file with coordinates for d5flka1.
(The format of our PDB-style files is described here.)

Timeline for d5flka1:

  • d5flka1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-30

View in 3D
Domains from same chain:
(mouse over for more information)
d5flka2