Lineage for d5h2fu_ (5h2f u:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2324209Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2325087Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2325322Family a.60.12.2: PsbU-like [158539] (2 protein domains)
    Pfam PF06514
  6. 2325323Protein Photosystem II 12 kDa extrinsic protein PsbU [158540] (2 species)
  7. 2325324Species Thermosynechococcus elongatus [TaxId:146786] [158541] (2 PDB entries)
    Uniprot Q9F1L5 37-134
  8. 2325325Domain d5h2fu_: 5h2f u: [332319]
    Other proteins in same PDB: d5h2fa_, d5h2fb_, d5h2fc_, d5h2fd_, d5h2fe_, d5h2ff_, d5h2fh_, d5h2fj_, d5h2fk_, d5h2fl_, d5h2fo_, d5h2ft_, d5h2fv_, d5h2fx_, d5h2fz_
    automated match to d2axtu1
    complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl; mutant

Details for d5h2fu_

PDB Entry: 5h2f (more details), 2.2 Å

PDB Description: crystal structure of the psbm-deletion mutant of photosystem ii
PDB Compounds: (u:) Photosystem II 12 kDa extrinsic protein

SCOPe Domain Sequences for d5h2fu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h2fu_ a.60.12.2 (u:) Photosystem II 12 kDa extrinsic protein PsbU {Thermosynechococcus elongatus [TaxId: 146786]}
elvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipgl
terqkqilrenlehftvtevetalveggdrynnglyk

SCOPe Domain Coordinates for d5h2fu_:

Click to download the PDB-style file with coordinates for d5h2fu_.
(The format of our PDB-style files is described here.)

Timeline for d5h2fu_: