SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5h2fu_ (5h2f u:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998615Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1999483Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 1999718Family a.60.12.2: PsbU-like [158539] (2 protein domains)
    Pfam PF06514
  6. 1999719Protein Photosystem II 12 kDa extrinsic protein PsbU [158540] (2 species)
  7. 1999720Species Thermosynechococcus elongatus [TaxId:146786] [158541] (2 PDB entries)
    Uniprot Q9F1L5 37-134
  8. 2289018Domain d5h2fu_: 5h2f u: [332319]
    Other proteins in same PDB: d5h2fo_
    automated match to d2axtu1
    complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl; mutant

Details for d5h2fu_

PDB Entry: 5h2f (more details), 2.2 Å

PDB Description: crystal structure of the psbm-deletion mutant of photosystem ii
PDB Compounds: (u:) Photosystem II 12 kDa extrinsic protein

SCOPe Domain Sequences for d5h2fu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h2fu_ a.60.12.2 (u:) Photosystem II 12 kDa extrinsic protein PsbU {Thermosynechococcus elongatus [TaxId: 146786]}
elvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipgl
terqkqilrenlehftvtevetalveggdrynnglyk

SCOPe Domain Coordinates for d5h2fu_:

Click to download the PDB-style file with coordinates for d5h2fu_.
(The format of our PDB-style files is described here.)

Timeline for d5h2fu_:

  • d5h2fu_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-24