Lineage for d5uvfa_ (5uvf A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2546221Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2546222Protein automated matches [190417] (27 species)
    not a true protein
  7. 2546365Species Human (Homo sapiens) [TaxId:9606] [187294] (946 PDB entries)
  8. 2546937Domain d5uvfa_: 5uvf A: [332318]
    automated match to d3op5a_
    complexed with 7dz, cl, peg, po4

Details for d5uvfa_

PDB Entry: 5uvf (more details), 2 Å

PDB Description: crystal structure of the human vaccinia-related kinase bound to bi- d1870
PDB Compounds: (A:) Serine/threonine-protein kinase VRK1

SCOPe Domain Sequences for d5uvfa_:

Sequence, based on SEQRES records: (download)

>d5uvfa_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aeqfavgeiitdmaaaawkvglpigqggfgciyladmnssesvgsdapcvvkvepsdngp
lftelkfyqraakpeqiqkwirtrklkylgvpkywgsglhdkngksyrfmimdrfgsdlq
kiyeanakrfsrktvlqlslrildileyiheheyvhgdikasnlllnyknpdqvylvdyg
layrycpegvhkayaadpkrchdgtieftsidahngvapsrrgdleilgycmiqwltghl
pwednlkdpkyvrdskiryreniaslmdkcfpaanapgeiakymetvklldytekplyen
lrdillqglkaigskddgkldl

Sequence, based on observed residues (ATOM records): (download)

>d5uvfa_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aeqfavgeiitdmaaaawkvglpigciyladmnssesvgsdapcvvkvepsdngplftel
kfyqraakpeqiqkwirtrklkylgvpkywgsglhdkngksyrfmimdrfgsdlqkiyea
nakrfsrktvlqlslrildileyiheheyvhgdikasnlllnyknpdqvylvdyglayry
cpegvhkayaadpkrchdgtieftsidahngvapsrrgdleilgycmiqwltghlpwedn
lkdpkyvrdskiryreniaslmdkcfpaanapgeiakymetvklldytekplyenlrdil
lqglkaigskddgkldl

SCOPe Domain Coordinates for d5uvfa_:

Click to download the PDB-style file with coordinates for d5uvfa_.
(The format of our PDB-style files is described here.)

Timeline for d5uvfa_: