SCOPe 2.06: Domain d5b3so1: 5b3s O:2-90

Lineage for d5b3so1 (5b3s O:2-90)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families)

5. Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)

6. Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81454] (35 PDB entries)

8. Domain d5b3so1: 5b3s O:2-90 [332315]
   Other proteins in same PDB: d5b3sa1, d5b3sa2, d5b3sb2, d5b3sb3, d5b3sc_, d5b3sd_, d5b3se_, d5b3sf_, d5b3sg_, d5b3sh_, d5b3si1, d5b3si2, d5b3sj_, d5b3sk_, d5b3sl_, d5b3sm_, d5b3sn1, d5b3sn2, d5b3so2, d5b3so3, d5b3sp_, d5b3sq_, d5b3sr_, d5b3ss_, d5b3st_, d5b3su_, d5b3sv1, d5b3sv2, d5b3sw_, d5b3sx_, d5b3sy_, d5b3sz_
   automated match to d1v54b2
   complexed with cdl, chd, cmo, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d5b3so1

PDB Entry: 5b3s, 1.68 Å

PDB Description: bovine heart cytochrome c oxidase in the carbon monoxide-bound mixed- valence state at 1.68 angstrom resolution (50 k)

PDB Compounds: (O:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d5b3so1:

Sequence; same for both SEQRES and ATOM records:

>d5b3so1 f.17.2.1 (O:2-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]}
aypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqev
etiwtilpaiililialpslrilymmdei

Timeline for d5b3so1:

• d5b3so1 is new in SCOPe 2.06-stable
  
• d5b3so1 appears in SCOPe 2.07
  
• d5b3so1 appears in the current release, SCOPe 2.08