SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5uwha_ (5uwh A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2110099Family c.37.1.8: G proteins [52592] (79 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2110833Protein Ran [52609] (2 species)
  7. 2110834Species Dog (Canis familiaris) [TaxId:9615] [52610] (20 PDB entries)
    Uniprot P62825
  8. 2289011Domain d5uwha_: 5uwh A: [332312]
    Other proteins in same PDB: d5uwhb_
    automated match to d1qg4b_
    complexed with gnp, gol, mg

Details for d5uwha_

PDB Entry: 5uwh (more details), 2.26 Å

PDB Description: crystal structure of paxillin nes peptide in complex with crm1-ran- ranbp1
PDB Compounds: (A:) GTP-binding nuclear protein ran

SCOPe Domain Sequences for d5uwha_:

Sequence, based on SEQRES records: (download)

>d5uwha_ c.37.1.8 (A:) Ran {Dog (Canis familiaris) [TaxId: 9615]}
vqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdtag
qekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdikd
rkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappevv
mdpalaaqyehdlevaqttalpdedddl

Sequence, based on observed residues (ATOM records): (download)

>d5uwha_ c.37.1.8 (A:) Ran {Dog (Canis familiaris) [TaxId: 9615]}
vqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdtag
qekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdikd
rkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappevl
aaqyehdlevaqttalpdedddl

SCOPe Domain Coordinates for d5uwha_:

Click to download the PDB-style file with coordinates for d5uwha_.
(The format of our PDB-style files is described here.)

Timeline for d5uwha_:

  • d5uwha_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23