SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5trxb2 (5trx B:148-362)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2166686Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2166687Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2166848Family d.32.1.3: Extradiol dioxygenases [54602] (5 protein domains)
    duplication: consists of 2 similar domains with 2 repeats in each
    Similar to the Methylmalonyl-CoA epimerase dimer
  6. 2166939Protein Homoprotocatechuate 2,3-dioxygenase [89886] (2 species)
  7. 2166953Species Brevibacterium fuscum [TaxId:47914] [89888] (17 PDB entries)
  8. 2288988Domain d5trxb2: 5trx B:148-362 [332289]
    automated match to d1q0oa2
    complexed with ca, cl, fe2

Details for d5trxb2

PDB Entry: 5trx (more details), 2.38 Å

PDB Description: room temperature structure of an extradiol ring-cleaving dioxygenase from b.fuscum determined using serial femtosecond crystallography
PDB Compounds: (B:) homoprotocatechuate 2,3-dioxygenase

SCOPe Domain Sequences for d5trxb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5trxb2 d.32.1.3 (B:148-362) Homoprotocatechuate 2,3-dioxygenase {Brevibacterium fuscum [TaxId: 47914]}
gelvrldhfnqvtpdvprgrkyledlgfrvtediqddegttyaawmhrkgtvhdtaltgg
ngprlhhvafsthekhniiqicdkmgalrisdriergpgrhgvsnafylyildpdnhrie
iytqdyytgdpdnptitwnvhdnqrrdwwgnpvvpswyteaskvldldgnvqeiiertdd
selevtigadgfsftragdedgsyhgqaskgfklg

SCOPe Domain Coordinates for d5trxb2:

Click to download the PDB-style file with coordinates for d5trxb2.
(The format of our PDB-style files is described here.)

Timeline for d5trxb2:

  • d5trxb2 appears in periodic updates to SCOPe 2.06 starting on 2017-03-23